
Atlas Antibodies Anti-SARAF Antibody
상품 한눈에 보기
Human SARAF 단백질을 표적으로 하는 Polyclonal Rabbit 항체. store-operated calcium entry 조절 인자 연구에 적합. Affinity purification으로 높은 특이성과 재현성 보장. ICC 등 다양한 응용에 사용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SARAF Antibody
Target: store-operated calcium entry-associated regulatory factor (SARAF)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against Human SARAF protein.
Also known as MGC8721 or TMEM66.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
YSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFT
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | store-operated calcium entry-associated regulatory factor |
| Target Gene | SARAF |
| Alternative Gene Names | MGC8721, TMEM66 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (75%), Rat (70%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (Material Safety Data Sheet) |
Applications
- Recommended for Immunocytochemistry (ICC)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
