
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SARAF Antibody
상품 한눈에 보기
Human SARAF 단백질을 표적으로 하는 Polyclonal Rabbit 항체. store-operated calcium entry 조절 인자 연구에 적합. Affinity purification으로 높은 특이성과 재현성 보장. ICC 등 다양한 응용에 사용 가능.
- 카탈로그번호
- HPA040400-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA040400-100 Anti-SARAF Antibody, store-operated calcium entry-associated regulatory factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040400-25 Anti-SARAF Antibody, store-operated calcium entry-associated regulatory factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SARAF Antibody
Anti-SARAF Antibody
Target: store-operated calcium entry-associated regulatory factor (SARAF)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against Human SARAF protein.
Also known as MGC8721 or TMEM66.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
YSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFT
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | store-operated calcium entry-associated regulatory factor |
| Target Gene | SARAF |
| Alternative Gene Names | MGC8721, TMEM66 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (75%), Rat (70%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (Material Safety Data Sheet) |
Applications
- Recommended for Immunocytochemistry (ICC)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



