CacheBy
Atlas Antibodies Anti-SARAF Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SARAF Antibody

상품 한눈에 보기

Human SARAF 단백질을 표적으로 하는 Polyclonal Rabbit 항체. store-operated calcium entry 조절 인자 연구에 적합. Affinity purification으로 높은 특이성과 재현성 보장. ICC 등 다양한 응용에 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA040400-100 Anti-SARAF Antibody, store-operated calcium entry-associated regulatory factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040400-25 Anti-SARAF Antibody, store-operated calcium entry-associated regulatory factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SARAF Antibody

Anti-SARAF Antibody

Target: store-operated calcium entry-associated regulatory factor (SARAF)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against Human SARAF protein.
Also known as MGC8721 or TMEM66.

Open Datasheet


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    YSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFT

Target Information

항목 내용
Target Protein store-operated calcium entry-associated regulatory factor
Target Gene SARAF
Alternative Gene Names MGC8721, TMEM66
Verified Species Reactivity Human
Interspecies Identity Mouse (75%), Rat (70%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (Material Safety Data Sheet)

Applications

  • Recommended for Immunocytochemistry (ICC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.