CacheBy
Atlas Antibodies Anti-SARNP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SARNP Antibody

상품 한눈에 보기

Human SARNP 단백질을 인식하는 rabbit polyclonal antibody로, IHC, WB, ICC 등 다양한 응용에 적합. CIP29, Hcc-1, THO1 등 대체 유전자명과 교차 반응성이 검증됨. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

카탈로그번호
HPA030903-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030903-100 Anti-SARNP Antibody, SAP domain containing ribonucleoprotein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030903-25 Anti-SARNP Antibody, SAP domain containing ribonucleoprotein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SARNP Antibody

Anti-SARNP Antibody

SAP domain containing ribonucleoprotein


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SARNP.


Alternative Gene Names

CIP29, Hcc-1, THO1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein SAP domain containing ribonucleoprotein
Target Gene SARNP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SSDNKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTEDTEAKKRKRAERFGIA
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Mouse ENSMUSG00000078427 (99%), Rat ENSRNOG00000030520 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.