CacheBy
Atlas Antibodies Anti-SAR1B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SAR1B Antibody

상품 한눈에 보기

Human SAR1B 단백질을 인식하는 Rabbit Polyclonal Antibody. WB 및 IHC 실험에 적합하며, PrEST 항원을 이용해 친화 정제됨. Human에 반응하며 Mouse, Rat과 높은 서열 유사성 보유. GTPase 관련 단백질 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA048368-100 Anti-SAR1B Antibody, secretion associated, Ras related GTPase 1B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048368-25 Anti-SAR1B Antibody, secretion associated, Ras related GTPase 1B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SAR1B Antibody

Anti-SAR1B Antibody

Target: secretion associated, Ras related GTPase 1B (SAR1B)
Type: Polyclonal Antibody against Human SAR1B


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

This polyclonal antibody is raised in rabbit against the human SAR1B protein, a secretion-associated Ras-related GTPase. The antibody is affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • SARA2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein secretion associated, Ras related GTPase 1B
Target Gene SAR1B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHE
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000020386 (100%), Rat ENSRNOG00000004820 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.