
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SAR1B Antibody
상품 한눈에 보기
Human SAR1B 단백질을 인식하는 Rabbit Polyclonal Antibody. WB 및 IHC 실험에 적합하며, PrEST 항원을 이용해 친화 정제됨. Human에 반응하며 Mouse, Rat과 높은 서열 유사성 보유. GTPase 관련 단백질 연구에 활용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA048368-100 Anti-SAR1B Antibody, secretion associated, Ras related GTPase 1B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048368-25 Anti-SAR1B Antibody, secretion associated, Ras related GTPase 1B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SAR1B Antibody
Anti-SAR1B Antibody
Target: secretion associated, Ras related GTPase 1B (SAR1B)
Type: Polyclonal Antibody against Human SAR1B
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
This polyclonal antibody is raised in rabbit against the human SAR1B protein, a secretion-associated Ras-related GTPase. The antibody is affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
- SARA2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | secretion associated, Ras related GTPase 1B |
| Target Gene | SAR1B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000020386 (100%), Rat ENSRNOG00000004820 (99%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



