Atlas Antibodies Anti-SAR1B Antibody

상품 한눈에 보기

Human SAR1B 단백질을 인식하는 Rabbit Polyclonal Antibody. WB 및 IHC 실험에 적합하며, PrEST 항원을 이용해 친화 정제됨. Human에 반응하며 Mouse, Rat과 높은 서열 유사성 보유. GTPase 관련 단백질 연구에 활용 가능.

카탈로그번호: HPA048368-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA048368-100 Anti-SAR1B Antibody, secretion associated, Ras related GTPase 1B 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA048368-25 Anti-SAR1B Antibody, secretion associated, Ras related GTPase 1B 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SAR1B Antibody

Anti-SAR1B Antibody

Target: secretion associated, Ras related GTPase 1B (SAR1B)
Type: Polyclonal Antibody against Human SAR1B

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Product Description

This polyclonal antibody is raised in rabbit against the human SAR1B protein, a secretion-associated Ras-related GTPase. The antibody is affinity purified using the PrEST antigen as affinity ligand.

Alternative Gene Names

SARA2

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	secretion associated, Ras related GTPase 1B
Target Gene	SAR1B
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	TLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHE
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000020386 (100%), Rat ENSRNOG00000004820 (99%)