CacheBy
Atlas Antibodies Anti-SARDH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SARDH Antibody

상품 한눈에 보기

Human SARDH 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 검증 완료, 쥐 및 생쥐와 높은 서열 유사성 보유. 안정한 PBS/glycerol 버퍼에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA057267-100 Anti-SARDH Antibody, sarcosine dehydrogenase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057267-25 Anti-SARDH Antibody, sarcosine dehydrogenase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SARDH Antibody

Anti-SARDH Antibody

Target Protein: Sarcosine dehydrogenase
Recommended Applications: IHC, WB


Product Description

Polyclonal Antibody against Human SARDH

Alternative Gene Names

DMGDHL1, SDH

Open Datasheet


Target Information

항목 내용
Target Protein Sarcosine dehydrogenase
Target Gene SARDH
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence RERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQERHGWERPGWFHPRGPAPVLEYDYYGAYGSRAHEDYAYRRLLADEYTFAFPPHHDTIKKEC

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000006916 (85%)
  • Mouse ENSMUSG00000009614 (84%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Application: IHC
Recommended Application: WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.