
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RNPEP Antibody
상품 한눈에 보기
Human RNPEP 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 보존성을 가집니다. 단백질 발현 검증에 사용되는 신뢰성 높은 연구용 항체입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA061487-100 Anti-RNPEP Antibody, arginyl aminopeptidase (aminopeptidase B) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061487-25 Anti-RNPEP Antibody, arginyl aminopeptidase (aminopeptidase B) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RNPEP Antibody
Anti-RNPEP Antibody
Target: arginyl aminopeptidase (aminopeptidase B)
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, independent antibody validation)
- Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human RNPEP
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | arginyl aminopeptidase (aminopeptidase B) |
| Target Gene | RNPEP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | MKPAEELAQLWAAEELDMKAIEAVAISPWKTYQLVYFLDKILQKSPLPPGNVKKLGDTYPSISNARNAELRLRWGQI |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000006720 (90%) Mouse ENSMUSG00000041926 (87%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) containing 0.02% sodium azide as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



