CacheBy
Atlas Antibodies Anti-RNPEP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RNPEP Antibody

상품 한눈에 보기

Human RNPEP 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 보존성을 가집니다. 단백질 발현 검증에 사용되는 신뢰성 높은 연구용 항체입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061487-100 Anti-RNPEP Antibody, arginyl aminopeptidase (aminopeptidase B) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061487-25 Anti-RNPEP Antibody, arginyl aminopeptidase (aminopeptidase B) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RNPEP Antibody

Anti-RNPEP Antibody

Target: arginyl aminopeptidase (aminopeptidase B)


  • IHC (Immunohistochemistry)
  • WB (Western Blot, independent antibody validation)
    • Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human RNPEP
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein arginyl aminopeptidase (aminopeptidase B)
Target Gene RNPEP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MKPAEELAQLWAAEELDMKAIEAVAISPWKTYQLVYFLDKILQKSPLPPGNVKKLGDTYPSISNARNAELRLRWGQI
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000006720 (90%)
Mouse ENSMUSG00000041926 (87%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) containing 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.