Atlas Antibodies Anti-RNPEPL1 Antibody

상품 한눈에 보기

Human RNPEPL1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB(재조합 발현 검증), ICC에 적합. PrEST 항원을 이용해 친화 정제되었으며, 인간에 대해 검증됨. 글리세롤 및 PBS 완충액에 보존제 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036773-100 Anti-RNPEPL1 Antibody, arginyl aminopeptidase like 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036773-25 Anti-RNPEPL1 Antibody, arginyl aminopeptidase like 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: arginyl aminopeptidase (aminopeptidase B)-like 1
Type: Polyclonal Antibody against Human RNPEPL1

IHC (Immunohistochemistry)
WB (Western Blot) – Recombinant expression validation using target protein overexpression
ICC (Immunocytochemistry)

Polyclonal antibody against Human RNPEPL1, validated for multiple applications.
Open Datasheet (PDF)

항목	내용
Target Protein	arginyl aminopeptidase (aminopeptidase B)-like 1
Target Gene	RNPEPL1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Amino Acid Sequence	LEVFYQTQGRLHPNLRRAIQQILSQGLGSSTEPASEPSTELGKAEADTDSDAQALLLGDEAPSSAISLRDVNVSA
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000026269 (84%), Rat ENSRNOG00000045775 (80%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)