
Atlas Antibodies Anti-RNPEPL1 Antibody
상품 한눈에 보기
Human RNPEPL1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB(재조합 발현 검증), ICC에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 특이적으로 반응하며, 글리세롤 기반 완충액에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RNPEPL1 Antibody
Target: arginyl aminopeptidase (aminopeptidase B)-like 1
Type: Polyclonal Antibody against Human RNPEPL1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation using target protein overexpression
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human RNPEPL1.
Affinity purified using the PrEST antigen as affinity ligand.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | arginyl aminopeptidase (aminopeptidase B)-like 1 |
| Target Gene | RNPEPL1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LEVFYQTQGRLHPNLRRAIQQILSQGLGSSTEPASEPSTELGKAEADTDSDAQALLLGDEAPSSAISLRDVNVSA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse 84% (ENSMUSG00000026269), Rat 80% (ENSRNOG00000045775) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RNPEPL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RNPEP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RNPEPL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RNPEP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RNPC3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.