AI 생성

1 / 2

Atlas Antibodies Anti-RNPEP Antibody

상품 한눈에 보기

Human RNPEP 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 인간 단백질 발현 검증에 사용 가능. 고순도 및 높은 특이성을 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036075-100 Anti-RNPEP Antibody, arginyl aminopeptidase (aminopeptidase B) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036075-25 Anti-RNPEP Antibody, arginyl aminopeptidase (aminopeptidase B) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: arginyl aminopeptidase (aminopeptidase B)

Immunohistochemistry (IHC)
Western Blot (WB, Independent Antibody Validation)
- Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Immunocytochemistry (ICC)

Polyclonal Antibody against Human RNPEP
Open Datasheet (PDF)

항목	내용
Target Protein	arginyl aminopeptidase (aminopeptidase B)
Target Gene	RNPEP
Antigen Sequence Type	Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence	MKPAEELAQLWAAEELDMKAIEAVAISPWKTYQLVYFLDKILQKSPLPPGNVKKLGDTYPSISNARNAELRLRWGQI

항목	내용
Verified Reactivity	Human
Ortholog Identity	Rat ENSRNOG00000006720 (90%), Mouse ENSMUSG00000041926 (87%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

Enhanced Validation
IHC Application
WB Independent Validation
Independent Validation Tooltip
ICC Application

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.