CacheBy
Thermo Fisher Scientific UPF1 Polyclonal Antibody
원본

Thermo Fisher Scientific UPF1 Polyclonal Antibody

상품 한눈에 보기

UPF1 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체로, WB, IHC, ICC, Flow Cytometry 등 다양한 응용에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공되어 재구성 후 500 µg/mL 농도로 사용 가능합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 02:49
Thermo Fisher Scientific PA580208 UPF1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific UPF1 Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC-P) 0.5–1 µg/mL
Immunohistochemistry (Frozen) (IHC-F) 0.5–1 µg/mL
Immunocytochemistry (ICC/IF) 2 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

Property Description
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human RENT1/hUPF1 (578–614 aa: NMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAE)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions –20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2747322

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Upf1 is an active component in nonsense-mediated decay (NMD), an mRNA surveillance mechanism in eukaryotic cells that degrades mRNAs containing premature termination codons.
It functions as an ATP-dependent RNA helicase located in the cytoplasm and is a component of cytoplasmic P-bodies.
Upf1 phosphorylation mediates translational repression associated with NMD, allowing mRNA accessibility to the NMD machinery.
Other active components of NMD, Upf2 and Upf3, exhibit perinuclear and nucleocytoplasmic localization, respectively.


For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.