Thermo Fisher Scientific UPF1 Polyclonal Antibody
UPF1 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체로, WB, IHC, ICC, Flow Cytometry 등 다양한 응용에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공되어 재구성 후 500 µg/mL 농도로 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific UPF1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human RENT1/hUPF1 (578–614 aa: NMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747322 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Upf1 is an active component in nonsense-mediated decay (NMD), an mRNA surveillance mechanism in eukaryotic cells that degrades mRNAs containing premature termination codons.
It functions as an ATP-dependent RNA helicase located in the cytoplasm and is a component of cytoplasmic P-bodies.
Upf1 phosphorylation mediates translational repression associated with NMD, allowing mRNA accessibility to the NMD machinery.
Other active components of NMD, Upf2 and Upf3, exhibit perinuclear and nucleocytoplasmic localization, respectively.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.