원본
Thermo Fisher Scientific UPF3B Polyclonal Antibody
상품 한눈에 보기
Thermo Fisher Scientific의 UPF3B Polyclonal Antibody는 Human, Mouse, Rat 시료에서 Western blot 및 IHC(P) 분석에 적합합니다. C-말단 합성 펩타이드로 면역화된 Rabbit IgG 항체로, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 재구성 시 500 µg/mL 농도를 제공합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오후 09:30
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA580209 UPF3B Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific UPF3B Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human UPF3B / RENT3B (416–452aa SEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747323 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
UPF3B는 mRNA 핵 내 수출과 감시 과정에 관여하는 스플라이싱 후 다단백질 복합체의 구성 요소입니다. 이 단백질은 yeast Upf3p의 두 가지 기능적 상동체 중 하나로, mRNA에 결합하여 핵 내 수출 후에도 결합 상태를 유지하며 핵-세포질 셔틀 단백질로 작용합니다. Y14와 복합체를 형성하여 엑손-엑손 접합부 상류 20 nt 부근에 특이적으로 결합합니다. 이 유전자는 X 염색체 장완에 위치하며, 두 가지 스플라이스 변이체가 존재합니다. mRNA 감시 시스템은 조기 종결 코돈을 포함한 mRNA를 인식하여 nonsense-mediated mRNA decay (NMD)를 유도합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific USP7 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific UPF1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific UGT1A1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific UHRF2 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.