Thermo Fisher Scientific UPF3B Polyclonal Antibody
Thermo Fisher Scientific의 UPF3B Polyclonal Antibody는 Human, Mouse, Rat 시료에서 Western blot 및 IHC(P) 분석에 적합합니다. C-말단 합성 펩타이드로 면역화된 Rabbit IgG 항체로, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 재구성 시 500 µg/mL 농도를 제공합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human UPF3B / RENT3B (416–452aa SEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747323 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
UPF3B는 mRNA 핵 내 수출과 감시 과정에 관여하는 스플라이싱 후 다단백질 복합체의 구성 요소입니다. 이 단백질은 yeast Upf3p의 두 가지 기능적 상동체 중 하나로, mRNA에 결합하여 핵 내 수출 후에도 결합 상태를 유지하며 핵-세포질 셔틀 단백질로 작용합니다. Y14와 복합체를 형성하여 엑손-엑손 접합부 상류 20 nt 부근에 특이적으로 결합합니다. 이 유전자는 X 염색체 장완에 위치하며, 두 가지 스플라이스 변이체가 존재합니다. mRNA 감시 시스템은 조기 종결 코돈을 포함한 mRNA를 인식하여 nonsense-mediated mRNA decay (NMD)를 유도합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific USP7 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific UPF1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific UPF3B Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific UGT1A1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific UHRF2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|