
Atlas Antibodies Anti-CRIP2 Antibody
상품 한눈에 보기
Human CRIP2 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC에 적합. Rabbit 유래 IgG이며, PrEST 항원으로 정제됨. 인간에 특이적 반응성을 가지며, 쥐와 생쥐와도 높은 서열 유사성(84%)을 보임. 40% 글리세롤과 PBS 완충액에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CRIP2 Antibody
Target: cysteine-rich protein 2 (CRIP2)
Supplier: Atlas Antibodies
Recommended Applications
- WB (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC
Product Description
Polyclonal antibody against Human CRIP2.
Alternative Gene Names
- CRP2
- ESP1
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | cysteine-rich protein 2 |
| Target Gene | CRIP2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAE |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000005041 (84%), Mouse ENSMUSG00000006356 (84%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
