
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CRHBP Antibody
상품 한눈에 보기
Human CRHBP 단백질을 인식하는 토끼 폴리클로날 항체로, 코르티코트로핀 방출 호르몬 결합 단백질 연구에 적합. WB 등 다양한 응용에 사용 가능하며, 친화 정제된 고순도 항체. 인간에 특이적 반응성을 보임.
- 카탈로그번호
- HPA036234-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036234-100 Anti-CRHBP Antibody, corticotropin releasing hormone binding protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036234-25 Anti-CRHBP Antibody, corticotropin releasing hormone binding protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CRHBP Antibody
Anti-CRHBP Antibody
Full Name: Corticotropin Releasing Hormone Binding Protein (CRHBP)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human CRHBP, suitable for various research applications.
Recommended Applications
- Western Blot (WB)
Alternative Gene Names
- CRF-BP
- CRFBP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Corticotropin releasing hormone binding protein |
| Target Gene | CRHBP |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Reactivity | Human |
| Ortholog Identity | Mouse ENSMUSG00000021680 (84%) Rat ENSRNOG00000017890 (81%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.


