원본
Atlas Antibodies Anti-CRH Antibody
상품 한눈에 보기
Human CRH 단백질을 인식하는 토끼 폴리클로날 항체로, 코르티코트로핀 방출 호르몬 연구에 적합. PrEST 항원으로 친화 정제됨. IHC 등 다양한 응용에 사용 가능. Human에 대해 검증됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA062111-100 Anti-CRH Antibody, corticotropin releasing hormone 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062111-25 Anti-CRH Antibody, corticotropin releasing hormone 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CRH Antibody
Anti-CRH Antibody
Target: corticotropin releasing hormone (CRH)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human corticotropin releasing hormone (CRH).
Alternative gene name: CRF
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | corticotropin releasing hormone |
| Target Gene | CRH |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | CRALLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000049796 (67%), Rat ENSRNOG00000012703 (65%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol, PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.