Atlas Antibodies Anti-CREM Antibody

상품 한눈에 보기

Human CREM 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터와의 정합을 통한 정교한 직교 검증 수행. 고순도 친화정제 방식으로 제조되며, Human, Mouse, Rat에 반응. 연구용으로 신뢰성 높은 단백질 발현 분석에 적합.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA001818-100 Anti-CREM Antibody, cAMP responsive element modulator 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA001818-25 Anti-CREM Antibody, cAMP responsive element modulator 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CREM Antibody

Anti-CREM Antibody

cAMP responsive element modulator

Recommended Applications

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody against human CREM.

Alternative Gene Names

hCREM-2

Open Datasheet

Target Information

항목	내용
Target Protein	cAMP responsive element modulator
Target Gene	CREM
Antigen Sequence Type	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence	QHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSD