Atlas Antibodies Anti-CNNM4 Antibody
Human CNNM4 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 등 다양한 응용에 적합하며 RNA-seq 데이터 기반 Orthogonal Validation 완료. PrEST 항원을 이용해 Affinity 정제된 고품질 항체.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-CNNM4 Antibody
Anti-CNNM4 Antibody
Target: cyclin and CBS domain divalent metal cation transport mediator 4
Type: Polyclonal Antibody against Human CNNM4
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody raised in rabbit against Human CNNM4 protein.
Validated by orthogonal methods comparing IHC and RNA-seq expression data.
Alternative Gene Names
ACDP4, KIAA1592
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cyclin and CBS domain divalent metal cation transport mediator 4 |
| Target Gene | CNNM4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000015886 (78%), Mouse ENSMUSG00000037408 (77%) |
Antigen Sequence (Amino Acid):
FSYYGTMALTSVPSDRSPAHPTPLSRSASLSYPDRTDVSTAATLAGSSNQFGSSVLGQYISDFSVRALVDLQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSL
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.