CacheBy
Atlas Antibodies Anti-CNNM4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CNNM4 Antibody

상품 한눈에 보기

Human CNNM4 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 등 다양한 응용에 적합하며 RNA-seq 데이터 기반 Orthogonal Validation 완료. PrEST 항원을 이용해 Affinity 정제된 고품질 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017732-100 Anti-CNNM4 Antibody, cyclin and CBS domain divalent metal cation transport mediator 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017732-25 Anti-CNNM4 Antibody, cyclin and CBS domain divalent metal cation transport mediator 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CNNM4 Antibody

Anti-CNNM4 Antibody

Target: cyclin and CBS domain divalent metal cation transport mediator 4
Type: Polyclonal Antibody against Human CNNM4


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody raised in rabbit against Human CNNM4 protein.
Validated by orthogonal methods comparing IHC and RNA-seq expression data.


Alternative Gene Names

ACDP4, KIAA1592

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein cyclin and CBS domain divalent metal cation transport mediator 4
Target Gene CNNM4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000015886 (78%), Mouse ENSMUSG00000037408 (77%)

Antigen Sequence (Amino Acid):
FSYYGTMALTSVPSDRSPAHPTPLSRSASLSYPDRTDVSTAATLAGSSNQFGSSVLGQYISDFSVRALVDLQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSL


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.