
Atlas Antibodies Anti-CNNM4 Antibody
Human CNNM4 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 등 다양한 응용에 적합하며 RNA-seq 데이터 기반 Orthogonal Validation 완료. PrEST 항원을 이용해 Affinity 정제된 고품질 항체.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CNNM4 Antibody
Target: cyclin and CBS domain divalent metal cation transport mediator 4
Type: Polyclonal Antibody against Human CNNM4
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody raised in rabbit against Human CNNM4 protein.
Validated by orthogonal methods comparing IHC and RNA-seq expression data.
Alternative Gene Names
ACDP4, KIAA1592
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cyclin and CBS domain divalent metal cation transport mediator 4 |
| Target Gene | CNNM4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000015886 (78%), Mouse ENSMUSG00000037408 (77%) |
Antigen Sequence (Amino Acid):
FSYYGTMALTSVPSDRSPAHPTPLSRSASLSYPDRTDVSTAATLAGSSNQFGSSVLGQYISDFSVRALVDLQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSL
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CNOT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CNNM3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CNNM4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CNNM2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CNNM2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|