CacheBy
Atlas Antibodies Anti-CNNM2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CNNM2 Antibody

상품 한눈에 보기

Human CNNM2 단백질을 타깃으로 하는 폴리클로날 항체로, WB 및 ICC에 적합합니다. Rabbit에서 생산된 IgG 형식이며, PrEST 항원으로 친화 정제되었습니다. Human에 대한 반응성이 검증되었고, 높은 종간 유사성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059954-100 Anti-CNNM2 Antibody, cyclin and CBS domain divalent metal cation transport mediator 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059954-25 Anti-CNNM2 Antibody, cyclin and CBS domain divalent metal cation transport mediator 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CNNM2 Antibody

Anti-CNNM2 Antibody

Target: cyclin and CBS domain divalent metal cation transport mediator 2
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human CNNM2


Alternative Gene Names

  • ACDP2

Open Datasheet


Target Information

  • Protein: cyclin and CBS domain divalent metal cation transport mediator 2
  • Gene: CNNM2

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

AVGENEETVIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVYGQNINNETWSRIAFTEHE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000064105 98%
Rat ENSRNOG00000020113 98%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.