CacheBy
Atlas Antibodies Anti-CNNM2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CNNM2 Antibody

상품 한눈에 보기

Human CNNM2 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 보입니다. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA071631-100 Anti-CNNM2 Antibody, cyclin and CBS domain divalent metal cation transport mediator 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071631-25 Anti-CNNM2 Antibody, cyclin and CBS domain divalent metal cation transport mediator 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CNNM2 Antibody

Anti-CNNM2 Antibody

Target: cyclin and CBS domain divalent metal cation transport mediator 2 (CNNM2)
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CNNM2.


Alternative Gene Names

  • ACDP2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein cyclin and CBS domain divalent metal cation transport mediator 2
Target Gene CNNM2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AVGENEETVIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVYGQNINNETWSRIAFTEHE

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 일치율
Rat ENSRNOG00000020113 98%
Mouse ENSMUSG00000064105 98%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 대한 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.