Atlas Antibodies Anti-CNOT1 Antibody

상품 한눈에 보기

Human CNOT1 단백질을 인식하는 폴리클로날 항체로, CCR4-NOT 전사 복합체 연구에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 정제되었습니다. IHC 등 다양한 응용 분야에 사용 가능합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA049664-100 Anti-CNOT1 Antibody, CCR4-NOT transcription complex, subunit 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA049664-25 Anti-CNOT1 Antibody, CCR4-NOT transcription complex, subunit 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: CCR4-NOT transcription complex, subunit 1
Supplier: Atlas Antibodies

면역조직화학(IHC) 등 다양한 연구 응용에 적합합니다.

Polyclonal antibody against human CNOT1.

AD-005, CDC39, KIAA1007, NOT1, NOT1H

항목	내용
Target Protein	CCR4-NOT transcription complex, subunit 1
Target Gene	CNOT1
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000036550 (100%) Rat ENSRNOG00000012271 (100%)

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TIETLMRINAHSRGNAPEGLPQLMEVVRSNYEAMIDRAHGGPNFMMHSGISQASEYDDPPGLREKAEYLLREWVNLYHSAAAGRDSTKAFSAFVG

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet