Thermo Fisher Scientific TNFRSF11B Polyclonal Antibody, Biotin, PeproTech

Thermo Fisher Scientific TNFRSF11B Polyclonal Antibody, Biotin, PeproTech

Applications and Tested Dilution

Product Specifications

Product Specific Information

AA Sequence of recombinant protein:
METFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQK

Preparation:
Produced from sera of rabbits immunized with highly pure Recombinant Human OPG. Anti-Human OPG-specific antibody was purified by affinity chromatography and then biotinylated.

Sandwich ELISA:
To detect Human OPG by sandwich ELISA (using 100 µL/well antibody solution), a concentration of 0.25–1.0 µg/mL of this antibody is required. This biotinylated polyclonal antibody, in conjunction with PeproTech Polyclonal Anti-Human OPG (500-P149) as a capture antibody, allows detection of at least 0.2–0.4 ng/well of Recombinant Human OPG.

Western Blot:
To detect hOPG by Western Blot analysis, this antibody can be used at a concentration of 0.1–0.2 µg/mL. Used with compatible secondary reagents, the detection limit for Recombinant hOPG is 1.5–3.0 ng/lane under either reducing or non-reducing conditions.

Packaging:
500-P149BT-1MG will be provided as 2 × 500 µg.

Target Information

The protein encoded by this gene (TNFRSF11B) is a member of the TNF-receptor superfamily. It acts as an osteoblast-secreted decoy receptor that negatively regulates bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand, both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart suggest roles in lymph-node organogenesis and vascular calcification. Alternatively spliced transcript variants have been reported, but their full-length nature has not been determined.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.