Thermo Fisher Scientific NFE2L1 Polyclonal Antibody
NFE2L1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal 항체로, WB, IHC, ICC, ELISA에 적합합니다. 인간, 마우스, 랫트 시료에 반응하며, 고순도 친화 크로마토그래피로 정제되었습니다. 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:50–1:200 |
| Immunocytochemistry (ICC/IF) | 1:50–1:200 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein corresponding to amino acids 515–772 of human NFE2L1 (NP_0031951) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1.894 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2805893 |
Product Specific Information
Immunogen sequence:
SSSFSEEGAVGYSSDSETLDLEEAEGAVGYQPEYSKFCRMSYQDPAQLSCLPYLEHVGHNHTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIPFTNDKIINLPVEEFNELLSKYQLSEAQLSLIRDIRRRGKNKMAAQNCRKRKLDTILNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKDRRK
Positive Samples: HepG2, Jurkat, PC-12, Mouse fat, Mouse lung, Mouse liver
Cellular Location: Endoplasmic reticulum membrane, Nucleus, Single-pass type II membrane protein
Target Information
This gene encodes a protein involved in globin gene expression in erythrocytes. Note that confusion has occurred in bibliographic databases due to the shared symbol "NRF1" for this gene (NFE2L1) and for nuclear respiratory factor 1, which officially uses the symbol NRF1.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific P-Glycoprotein Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific S100P Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific NFE2L1 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific PTPRN2 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific Radixin Polyclonal Antibody
618,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|