Thermo Fisher Scientific NFE2L1 Polyclonal Antibody
NFE2L1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal 항체로, WB, IHC, ICC, ELISA에 적합합니다. 인간, 마우스, 랫트 시료에 반응하며, 고순도 친화 크로마토그래피로 정제되었습니다. 연구용으로만 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific NFE2L1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:50–1:200 |
| Immunocytochemistry (ICC/IF) | 1:50–1:200 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein corresponding to amino acids 515–772 of human NFE2L1 (NP_0031951) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1.894 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2805893 |
Product Specific Information
Immunogen sequence:
SSSFSEEGAVGYSSDSETLDLEEAEGAVGYQPEYSKFCRMSYQDPAQLSCLPYLEHVGHNHTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIPFTNDKIINLPVEEFNELLSKYQLSEAQLSLIRDIRRRGKNKMAAQNCRKRKLDTILNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKDRRK
Positive Samples: HepG2, Jurkat, PC-12, Mouse fat, Mouse lung, Mouse liver
Cellular Location: Endoplasmic reticulum membrane, Nucleus, Single-pass type II membrane protein
Target Information
This gene encodes a protein involved in globin gene expression in erythrocytes. Note that confusion has occurred in bibliographic databases due to the shared symbol "NRF1" for this gene (NFE2L1) and for nuclear respiratory factor 1, which officially uses the symbol NRF1.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.