CacheBy
Thermo Fisher Scientific DVL1 Polyclonal Antibody
원본

Thermo Fisher Scientific DVL1 Polyclonal Antibody

상품 한눈에 보기

Rabbit polyclonal antibody targeting human DVL1 protein. Validated for WB and IHC(P) applications. Lyophilized form, reconstitutable to 500 µg/mL. Suitable for research use only, not for diagnostic or resale purposes.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오후 07:01
Thermo Fisher Scientific PA579176 DVL1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
621,000원VAT 포함 683,100원

Thermo Fisher Scientific · Thermo Fisher Scientific DVL1 Polyclonal Antibody

Applications

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL

Product Specifications

Property Description
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human DVL1 (401–438aa: APQLEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLK)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2746292

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

DVL1, the human homolog of the Drosophila dishevelled gene (dsh), encodes a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes including segmentation and neuroblast specification. DVL1 is a candidate gene for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1, and the phenotypes of these diseases may be consistent with defects expected from aberrant expression of a DVL gene during development.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.