CacheBy
Thermo Fisher Scientific FUT1 Polyclonal Antibody
원본

Thermo Fisher Scientific FUT1 Polyclonal Antibody

상품 한눈에 보기

FUT1 단백질을 인식하는 Rabbit Polyclonal Antibody로, WB 및 IHC(P) 실험에 적합. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 형태. 연구용으로만 사용 가능.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 10:52
Thermo Fisher Scientific PA579287 FUT1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific FUT1 Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 0.1–0.5 µg/mL

Immunohistochemistry (Paraffin) (IHC (P))

  • Tested Dilution: 0.5–1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human FUT1 (134–164aa EVDSRTPWRELQLHDWMSEEYADLRDPFLKL)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage conditions -20°C
Shipping conditions Wet ice
RRID AB_2746403

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

FUT1 is a Golgi stack membrane protein involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지: PA5-79287_FUT1_P19526-1_Rabbit.svg)
(이미지: PA5-79287_FUT1_P19526-1_Rabbit_PDP.jpeg)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.