
Thermo Fisher Scientific FUT1 Polyclonal Antibody
FUT1 단백질을 인식하는 Rabbit Polyclonal Antibody로, WB 및 IHC(P) 실험에 적합. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 형태. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human FUT1 (134–164aa EVDSRTPWRELQLHDWMSEEYADLRDPFLKL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Wet ice |
| RRID | AB_2746403 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
FUT1 is a Golgi stack membrane protein involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지: PA5-79287_FUT1_P19526-1_Rabbit.svg)
(이미지: PA5-79287_FUT1_P19526-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific GABRA1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific GABRB3 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific FUT1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific PLM Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific GADD45G Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|