Atlas Antibodies Anti-PSMD4 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA039252-100 | - | Atlas Antibodies HPA039252-100 Anti-PSMD4 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA039252-25 | - | Atlas Antibodies HPA039252-25 Anti-PSMD4 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-PSMD4 Antibody
proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human PSMD4
Alternative Gene Names
AF, AF-1, Rpn10, S5A
Target Protein
proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
Target Gene
PSMD4
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
AESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNA
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000021042 (96%)
Mouse ENSMUSG00000005625 (87%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|