Atlas Antibodies Anti-PSMD13 Antibody

상품 한눈에 보기

Human PSMD13 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 상동성을 보입니다. 40% 글리세롤 기반 PBS 버퍼에 보존되어 있습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038692-100 Anti-PSMD13 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 13 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038692-25 Anti-PSMD13 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 13 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: proteasome (prosome, macropain) 26S subunit, non-ATPase, 13
Supplier: Atlas Antibodies

Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human PSMD13

p40.5, Rpn9

항목	내용
Target Protein	proteasome (prosome, macropain) 26S subunit, non-ATPase, 13
Target Gene	PSMD13
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	ERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQTLKTAWGQQPDLAANEAQLLR
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000014109 (96%), Mouse ENSMUSG00000025487 (95%)