Atlas Antibodies Anti-PSMD4 Antibody

상품 한눈에 보기

Human PSMD4 단백질을 표적으로 하는 폴리클로날 Rabbit IgG 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. 독립 항체 및 재조합 발현 검증을 통해 신뢰성 확보. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039252-100 Anti-PSMD4 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039252-25 Anti-PSMD4 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
Supplier: Atlas Antibodies

IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Recombinant Expression Validation): Recombinant expression validation in WB using target protein overexpression.
ICC (Immunocytochemistry)

Polyclonal antibody against Human PSMD4.

AF, AF-1, Rpn10, S5A

항목	내용
Target Protein	proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
Target Gene	PSMD4
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	AESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNA
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000021042 (96%), Mouse ENSMUSG00000005625 (87%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.