CacheBy
Atlas Antibodies Anti-PSMD14 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMD14 Antibody

상품 한눈에 보기

Human PSMD14 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Human, Mouse, Rat 종에서 반응성이 검증되었습니다. 안정적인 PBS/glycerol 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA002114-100 Anti-PSMD14 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002114-25 Anti-PSMD14 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMD14 Antibody

Anti-PSMD14 Antibody

Target Information

  • Target Protein: proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
  • Target Gene: PSMD14
  • Alternative Gene Names: pad1, POH1, Rpn11

Product Description

Polyclonal Antibody against Human PSMD14

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

AVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDA

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000061129 100%
Mouse ENSMUSG00000026914 100%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.