AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPWD1 Antibody
상품 한눈에 보기
인간 PPWD1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 서열 동일성을 보여줍니다. 안정적인 PBS/glycerol 버퍼에 보존제로 sodium azide가 포함되어 있습니다.
- 카탈로그번호
- HPA019360-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA019360-100 Anti-PPWD1 Antibody, peptidylprolyl isomerase domain and WD repeat containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019360-25 Anti-PPWD1 Antibody, peptidylprolyl isomerase domain and WD repeat containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPWD1 Antibody
Anti-PPWD1 Antibody
Target: Peptidylprolyl isomerase domain and WD repeat containing 1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
- WB (Western Blot)
Product Description
Polyclonal antibody against Human PPWD1
Alternative Gene Names
- KIAA0073
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Peptidylprolyl isomerase domain and WD repeat containing 1 |
| Target Gene | PPWD1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000012505 (97%) Mouse ENSMUSG00000021713 (97%) |
Antigen Sequence:
QAEGPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGFMIQTGDPTGTG
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.