Thermo Fisher Scientific FUS Polyclonal Antibody
FUS 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot에 적합합니다. Human, Mouse, Rat 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, PBS와 trehalose, sodium azide를 포함합니다. 연구용으로만 사용 가능합니다.
- 카탈로그번호
- PA579286
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific FUS Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human TLS / FUS (DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746402 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex.
The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm.
This protein belongs to the FET family of RNA-binding proteins, which are implicated in cellular processes such as regulation of gene expression, maintenance of genomic integrity, and mRNA/microRNA processing.
Alternative splicing results in multiple transcript variants.
Defects in this gene result in amyotrophic lateral sclerosis type 6 (ALS6).
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.