Thermo Fisher Scientific FUS Polyclonal Antibody
FUS 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot에 적합합니다. Human, Mouse, Rat 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, PBS와 trehalose, sodium azide를 포함합니다. 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human TLS / FUS (DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746402 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex.
The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm.
This protein belongs to the FET family of RNA-binding proteins, which are implicated in cellular processes such as regulation of gene expression, maintenance of genomic integrity, and mRNA/microRNA processing.
Alternative splicing results in multiple transcript variants.
Defects in this gene result in amyotrophic lateral sclerosis type 6 (ALS6).
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific GAA Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific FZD3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific FUS Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific FSTL3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Follistatin Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|