Thermo Fisher Scientific ATF6 Polyclonal Antibody
ATF6 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot 및 IHC(P) 분석에 적합합니다. 인간, 마우스, 랫트 시료에 반응하며, 동결건조 형태로 제공됩니다. ER 스트레스 반응 연구 및 단백질 발현 분석에 활용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ATF6 (597–629aa: AININENVINGQDYEVMMQIDCQVMDTRILHIK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | Store at 4°C short term. For long term, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2884820 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ATF6 is a transcription factor activated during endoplasmic reticulum (ER) stress, regulating unfolded protein response (UPR) target genes. It binds DNA at the ER stress response element (ERSE) and ERSE II sequences, requiring NF-Y binding for full activation.
ATF6 exists as both homodimers and heterodimers (with ATF6 beta) and interacts with NF-Y, GTF2I, YY1, and SRF transcription factors.
Under ER stress, the cleaved N-terminal cytoplasmic domain translocates into the nucleus, functioning as a transcription factor. The basic domain acts as a nuclear localization signal, while the basic leucine-zipper domain mediates NF-Y association and DNA binding.
During UPR, an approximately 50 kDa fragment containing the transcriptional domain is released by sequential cleavage via site-1 and site-2 proteases. ATF6 is N-glycosylated, phosphorylated by MAPK14/P38MAPK, and belongs to the bZIP family.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific CYP2C19 Polyclonal Antibody
680,400원
Thermo Fisher Scientific
Thermo Fisher Scientific Tec Polyclonal Antibody
680,400원
Thermo Fisher Scientific
Thermo Fisher Scientific ATF6 Polyclonal Antibody
680,400원
Thermo Fisher Scientific
Thermo Fisher Scientific C9ORF72 Polyclonal Antibody
680,400원
Thermo Fisher Scientific
Thermo Fisher Scientific SLFN12 Polyclonal Antibody
680,400원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|