원본
Thermo Fisher Scientific Tec Polyclonal Antibody
상품 한눈에 보기
Human, Mouse, Rat에 반응하는 Rabbit Polyclonal Antibody로 Western Blot에 최적화됨. 합성 human Tec 펩타이드를 면역원으로 사용. 친화 크로마토그래피로 정제된 동결건조 형태. 단기 4°C, 장기 -20°C 보관 권장. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 08:07
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA5114365 Tec Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
680,400원VAT 포함 748,440원
Thermo Fisher Scientific · Thermo Fisher Scientific Tec Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human Tec (HDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2884822 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
TEC is a non-receptor protein-tyrosine kinase containing a pleckstrin homology domain and is highly expressed in many hematopoietic cell lines. They are key players in the regulation of immune functions. Tec kinase is an integral component of T cell signaling and has a distinct role in T cell activation. This gene may be associated with myelodysplastic syndrome.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific Cd8a Polyclonal Antibody680,400원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific CYP2C19 Polyclonal Antibody680,400원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific ATF6 Polyclonal Antibody680,400원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific C9ORF72 Polyclonal Antibody680,400원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.