Thermo Fisher Scientific Regucalcin Polyclonal Antibody
Regucalcin 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot 및 IHC(P)에서 검증됨. 인간, 생쥐, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 형태로 제공. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human Regucalcin (YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747039 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The protein encoded by this gene is a highly conserved, calcium-binding protein that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3–Xp11.23. Alternative splicing results in two transcript variants having different 5′ UTRs but encoding the same protein.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific RNF2 Polyclonal Antibody
514,100원
Thermo Fisher Scientific
Thermo Fisher Scientific RNASE3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Regucalcin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific RECK Polyclonal Antibody
599,200원
Thermo Fisher Scientific
Thermo Fisher Scientific RBP2 Polyclonal Antibody
514,100원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|