Thermo Fisher Scientific RECK Polyclonal Antibody

Applications

Western Blot (WB)

• Tested Dilution: 0.1–0.5 µg/mL

Product Specifications

Product Specific Information

The synthetic peptide sequence is:
NAQSDQGAMNDMKLWEKGSIKMPFINIPVLDIKKCQPEMWKAIA

Add 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

RECK is a cysteine-rich, extracellular protein with protease inhibitor-like domains whose expression is strongly suppressed in many tumors and cells transformed by various oncogenes. In normal cells, this membrane-anchored glycoprotein may serve as a negative regulator for matrix metalloproteinase-9 (MMP-9), a key enzyme involved in tumor invasion and metastasis.

For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.