Thermo Fisher Scientific RECK Polyclonal Antibody
RECK 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot에 적합하며, 합성 펩타이드 항원으로 제작됨. Lyophilized 형태, 재구성 시 500 µg/mL 농도. 종양 관련 단백질 연구용으로 적합.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific RECK Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human RECK (372–414) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747036 |
Product Specific Information
The synthetic peptide sequence is:
NAQSDQGAMNDMKLWEKGSIKMPFINIPVLDIKKCQPEMWKAIA
Add 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
RECK is a cysteine-rich, extracellular protein with protease inhibitor-like domains whose expression is strongly suppressed in many tumors and cells transformed by various oncogenes. In normal cells, this membrane-anchored glycoprotein may serve as a negative regulator for matrix metalloproteinase-9 (MMP-9), a key enzyme involved in tumor invasion and metastasis.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.