Thermo Fisher Scientific RNF2 Polyclonal Antibody
상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
PA579929 | - | Thermo Fisher Scientific PA579929 RNF2 Polyclonal Antibody 100 ug pk | 재고문의 | pk | 0원 | - | 0원 |
다른 상품 둘러보기
Applications
Tested Dilution
Publications
Western Blot (WB)
0.1-0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
0.5-1 µg/mL
Product Specifications
Host/Isotype
Rabbit / IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human RING2/ RING1B/RNF2.
Conjugate
Unconjugated Unconjugated Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_2747044
Product Specific Information
The synthetic peptide sequence is 257-290aa, DHLSKYLAVRLALEELRSKGESNQMNLDTASEKQ
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
Target Information
RNF2 (E3 ubiquitin-protein ligase RING2) is a ligase that mediates monoubiquitination of Lys-119 of histone H2A (H2AK119Ub). Therefore, it plays a central role in histone code and gene regulation. The ligase activity is enhanced by BMI1/PCGF4. H2AK119Ub gives a specific tag for epigeneti transcriptional repression and participates in X chromosome inactivation of female mammals. RNF2 may be involved in the initiation of both imprinted and random X inactivation. RNF2 is also an essential component of a Polycomb group (PcG) multiprotein PRC1-like complex. This complex class is required to maintain the transcriptionally repressive state of many genes including Hox genes throughout development. The PcG PRC1 complex acts via chromatin remodeling and modification of histones and rendering chromatin heritably changed in its expressibility.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|