Thermo Fisher Scientific RNF2 Polyclonal Antibody
RNF2 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체. Western blot과 파라핀 포매 조직 면역조직화학(IHC)에 적합. Rabbit IgG로 제작되었으며, 동결건조 형태로 제공. 히스톤 H2A 단일 유비퀴틴화 연구에 유용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific RNF2 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human RING2/RING1B/RNF2 |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747044 |
Product Specific Information
The synthetic peptide sequence is 257–290aa, DHLSKYLAVRLALEELRSKGESNQMNLDTASEKQ.
Add 0.2 mL of distilled water to obtain a final concentration of 500 µg/mL.
Target Information
RNF2 (E3 ubiquitin-protein ligase RING2) mediates monoubiquitination of Lys-119 of histone H2A (H2AK119Ub), playing a central role in histone code and gene regulation.
Its ligase activity is enhanced by BMI1/PCGF4. H2AK119Ub provides a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation in female mammals. RNF2 may be involved in both imprinted and random X inactivation.
It is an essential component of a Polycomb group (PcG) multiprotein PRC1-like complex, which maintains transcriptional repression of genes such as Hox during development through chromatin remodeling and histone modification.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.