Atlas Antibodies Anti-CCAR2 Antibody
인간 CCAR2 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. Human, Mouse, Rat 종에 반응하며, 세포주기 및 세포사멸 조절 연구에 유용합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-CCAR2 Antibody
Anti-CCAR2 Antibody
Cell Cycle and Apoptosis Regulator 2 (CCAR2)
Polyclonal antibody against human CCAR2 protein.
Recommended Applications
IHC (Orthogonal validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Independent validation)
Validation of protein expression in Western Blot by comparing independent antibodies targeting different epitopes of the protein.ICC
Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody against Human CCAR2.
Alternative Gene Names: DBC-1, DBC1, KIAA1967, NET35
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Cell cycle and apoptosis regulator 2 |
| Target Gene | CCAR2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse (82%), Rat (79%) |
Antigen Sequence:
MLLSLPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKDEAQNEGPATESEAPLKEDGLLPKPLSSGGEEEEKPRGEASEDLCEMALD
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.