Atlas Antibodies Anti-CCAR1 Antibody

상품 한눈에 보기

Human CCAR1 단백질을 인식하는 Rabbit Polyclonal 항체로, 세포 분열 및 세포사멸 조절 연구에 적합. IHC 및 WB 응용 가능. 높은 종간 보존성(인간, 생쥐, 랫드) 확인. Affinity purification으로 높은 특이도와 신뢰성 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA048513-100 Anti-CCAR1 Antibody, cell division cycle and apoptosis regulator 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA048513-25 Anti-CCAR1 Antibody, cell division cycle and apoptosis regulator 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CCAR1 Antibody

Anti-CCAR1 Antibody

Target: Cell division cycle and apoptosis regulator 1 (CCAR1)
Type: Polyclonal Antibody against Human CCAR1
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Alternative Gene Names

CARP-1, CARP1, FLJ10590

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	Cell division cycle and apoptosis regulator 1
Target Gene	CCAR1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Rat ENSRNOG00000000397 (94%), Mouse ENSMUSG00000020074 (93%)

Antigen Sequence

KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNED

Product Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand