CacheBy
Atlas Antibodies Anti-CC2D2B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CC2D2B Antibody

상품 한눈에 보기

인간 CC2D2B 단백질을 인식하는 폴리클로날 항체로, IHC 및 오쏘고날 검증에 적합합니다. Rabbit 호스트에서 생산되며, 고순도 Affinity 정제 방식으로 제조되었습니다. PBS 및 글리세롤 버퍼에 보존되어 안정성이 우수합니다.

카탈로그번호
HPA044091-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044091-100 Anti-CC2D2B Antibody, coiled-coil and C2 domain containing 2B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044091-25 Anti-CC2D2B Antibody, coiled-coil and C2 domain containing 2B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CC2D2B Antibody

Anti-CC2D2B Antibody

Target: coiled-coil and C2 domain containing 2B
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human CC2D2B.

Alternative Gene Names

bA248J23.4, C10orf130

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein coiled-coil and C2 domain containing 2B
Target Gene CC2D2B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000108929 (78%), Rat ENSRNOG00000059715 (45%)

Antigen Sequence:
VPSSSPVVNQRKLPKDMMPRILEDEGFYIQRKPEIYKKTCNKMENRLLKLEEGKCWFGESGEIMSLPTPIKQSWNF


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.