Atlas Antibodies Anti-CCAR2 Antibody

상품 한눈에 보기

인간 CCAR2 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 및 독립 항체 비교를 통한 검증 완료. 인간, 마우스, 랫트 반응성 확인. 프레스티 항원으로 친화 정제됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA019907-100 Anti-CCAR2 Antibody, cell cycle and apoptosis regulator 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA019907-25 Anti-CCAR2 Antibody, cell cycle and apoptosis regulator 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

cell cycle and apoptosis regulator 2

Orthogonal validation (IHC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Independent antibody validation (WB)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Polyclonal Antibody against Human CCAR2

DBC-1, DBC1, KIAA1967, NET35

항목	내용
Target Protein	cell cycle and apoptosis regulator 2
Target Gene	CCAR2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	MLLSLPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKDEAQNEGPATESEAPLKEDGLLPKPLSSGGEEEEKPRGEASEDLCEMALD
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Mouse ENSMUSG00000033712 (82%), Rat ENSRNOG00000018295 (79%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand