
Atlas Antibodies Anti-CCAR2 Antibody
인간 CCAR2 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 및 독립 항체 비교를 통한 검증 완료. 인간, 마우스, 랫트 반응성 확인. 프레스티 항원으로 친화 정제됨.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CCAR2 Antibody
cell cycle and apoptosis regulator 2
Recommended Applications
Orthogonal validation (IHC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.Independent antibody validation (WB)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human CCAR2
Alternative Gene Names
DBC-1, DBC1, KIAA1967, NET35
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cell cycle and apoptosis regulator 2 |
| Target Gene | CCAR2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MLLSLPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKDEAQNEGPATESEAPLKEDGLLPKPLSSGGEEEEKPRGEASEDLCEMALD |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000033712 (82%), Rat ENSRNOG00000018295 (79%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CCDC102A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CCDC102A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CCAR2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CCAR2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CCAR1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|