
Atlas Antibodies Anti-CAMLG Antibody
상품 한눈에 보기
Human CAMLG 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존도를 보입니다. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CAMLG Antibody
Target: Calcium Modulating Ligand (CAMLG)
Type: Polyclonal Antibody against Human CAMLG
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
This antibody is a rabbit polyclonal antibody raised against human CAMLG (calcium modulating ligand). It is affinity purified using the PrEST antigen as an affinity ligand to ensure high specificity and performance.
Alternative Gene Names
- CAML
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Calcium Modulating Ligand |
| Target Gene | CAMLG |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000021911 (88%), Mouse ENSMUSG00000021501 (84%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Composition
| 항목 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CAMSAP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CAMSAP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CAMLG Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CAMKV Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CAMLG Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.