AI 생성

1 / 2

Atlas Antibodies Anti-CAMSAP2 Antibody

상품 한눈에 보기

Human CAMSAP2 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 독립 검증을 통해 높은 신뢰성 확보. PrEST 항원으로 친화 정제. 인간 반응성 확인 및 마우스·랫과 높은 서열 유사성. 연구용 단백질 발현 분석에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA026304-100 Anti-CAMSAP2 Antibody, calmodulin regulated spectrin-associated protein family, member 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA026304-25 Anti-CAMSAP2 Antibody, calmodulin regulated spectrin-associated protein family, member 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Calmodulin regulated spectrin-associated protein family, member 2
Supplier: Atlas Antibodies

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human CAMSAP2

CAMSAP1L1, KIAA1078

항목	내용
Target Protein	Calmodulin regulated spectrin-associated protein family, member 2
Target Gene	CAMSAP2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000041570 (81%), Rat ENSRNOG00000008741 (77%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

SSVHGVSFDISFDKEDSVQRSTPNRGITRSISNEGLTLNNSHVSKHIRKNLSFKPINGEEEAESIEEELNIDSHSDLKSCVPL

Enhanced Validation
IHC Independent Validation
Tooltip Independent Validation

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.