CacheBy
Atlas Antibodies Anti-CAMLG Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CAMLG Antibody

상품 한눈에 보기

Human CAMLG 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 고순도 IgG 형식으로 제공됩니다. 사람에 대한 검증 완료, Rat 및 Mouse에서도 높은 서열 유사성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052636-100 Anti-CAMLG Antibody, calcium modulating ligand 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052636-25 Anti-CAMLG Antibody, calcium modulating ligand 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CAMLG Antibody

Anti-CAMLG Antibody

Target: Calcium modulating ligand (CAMLG)
Type: Polyclonal Antibody against Human CAMLG
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against the human CAMLG protein.
Alternative gene name: CAML

Open Datasheet (PDF)


Antigen Information

Target Protein: Calcium modulating ligand
Target Gene: CAMLG
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

GDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEE

Species Reactivity

  • Verified Species: Human
  • Ortholog Identity:
    • Rat ENSRNOG00000021911 (88%)
    • Mouse ENSMUSG00000021501 (84%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen
Storage Store at -20°C; avoid repeated freeze-thaw cycles
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.