
Atlas Antibodies Anti-CAMSAP2 Antibody
상품 한눈에 보기
Human CAMSAP2 단백질을 인식하는 고품질 폴리클로날 항체. IHC 독립 검증을 통해 신뢰성 확보. Rabbit 유래 IgG로 PrEST 항원 기반 친화 정제. 인간 시료에 최적화되어 높은 특이성과 재현성을 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CAMSAP2 Antibody
Target: calmodulin regulated spectrin-associated protein family, member 2
Supplier: Atlas Antibodies
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human CAMSAP2.
Alternative Gene Names
CAMSAP1L1, KIAA1078
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | calmodulin regulated spectrin-associated protein family, member 2 |
| Target Gene | CAMSAP2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000041570 (81%), Rat ENSRNOG00000008741 (77%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
SSVHGVSFDISFDKEDSVQRSTPNRGITRSISNEGLTLNNSHVSKHIRKNLSFKPINGEEEAESIEEELNIDSHSDLKSCVPLNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CAMP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CAMSAP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CAMSAP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CAMLG Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CAMKV Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.