
Atlas Antibodies Anti-C9orf142 Antibody
상품 한눈에 보기
사람 C9orf142 단백질을 인식하는 토끼 폴리클로날 항체로, WB, IHC, ICC에 적합합니다. siRNA knockdown을 통한 유전적 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C9orf142 Antibody
Target: chromosome 9 open reading frame 142 (C9orf142)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Genetic validation by siRNA knockdown
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human C9orf142.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 9 open reading frame 142 |
| Target Gene | C9orf142 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000015294 (79%), Mouse ENSMUSG00000047617 (78%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative (MSDS) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C9orf16 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C9orf152 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C9orf142 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C9orf135 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C9orf135 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.