CacheBy
Atlas Antibodies Anti-C9orf135 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C9orf135 Antibody

상품 한눈에 보기

Human C9orf135 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 WB에서 사용 가능. PrEST 항원으로 친화 정제되었으며 재조합 발현 검증 완료. PBS/glycerol buffer에 보존제로 sodium azide 포함.

카탈로그번호
HPA021325-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021325-100 Anti-C9orf135 Antibody, chromosome 9 open reading frame 135 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021325-25 Anti-C9orf135 Antibody, chromosome 9 open reading frame 135 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C9orf135 Antibody

Anti-C9orf135 Antibody

Target: chromosome 9 open reading frame 135 (C9orf135)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
    Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody against human C9orf135.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 9 open reading frame 135
Target Gene C9orf135
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000033053 (69%), Rat ENSRNOG00000036615 (63%)

Antigen Sequence:

MDSLDRSCQDWCDRKQHWLEIGPPDLVERKGSLTLRSHHKKYSKPVLVYSWHRDREAFPKGYDIEGPEKVK

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.