AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C9orf16 Antibody
상품 한눈에 보기
Human C9orf16 단백질을 인식하는 토끼 폴리클로날 항체로 IHC, WB, ICC에 적합. PrEST 항원을 이용해 친화 정제됨. 높은 종 간 보존성(마우스·랫 94%)을 보여 연구용으로 안정적 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA020725-100 Anti-C9orf16 Antibody, chromosome 9 open reading frame 16 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020725-25 Anti-C9orf16 Antibody, chromosome 9 open reading frame 16 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C9orf16 Antibody
Anti-C9orf16 Antibody
Target: chromosome 9 open reading frame 16 (C9orf16)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human C9orf16.
Alternative Gene Names
EST00098, FLJ12823, MGC4639
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 9 open reading frame 16 |
| Target Gene | C9orf16 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | NGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLGEAPSDASP |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to:
- Mouse (ENSMUSG00000039195): 94%
- Rat (ENSRNOG00000022681): 94%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.