CacheBy
Atlas Antibodies Anti-C9orf152 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C9orf152 Antibody

상품 한눈에 보기

Human C9orf152 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 안정적인 PBS/glycerol 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050769-100 Anti-C9orf152 Antibody, chromosome 9 open reading frame 152 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050769-25 Anti-C9orf152 Antibody, chromosome 9 open reading frame 152 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C9orf152 Antibody

Anti-C9orf152 Antibody

Target: chromosome 9 open reading frame 152 (C9orf152)
Clonality: Polyclonal
Host: Rabbit
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C9orf152.

Alternative Gene Names

  • bA470J20.2

Open Datasheet (PDF)


Antigen Information

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):

PQDTSHQVHHRGKLVGSDQRLPPEGDTHLFETNQMTQQGTGIPEAAQLPCQVGNTQTKAVESGLKFSTQCPLSIKNPHRSGKPAYYPFPQRKTPRISQAARNL


Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000052117 49%
Rat ENSRNOG00000012068 49%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.
Safety Material Safety Data Sheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.