
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C9orf152 Antibody
상품 한눈에 보기
Human C9orf152 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 안정적인 PBS/glycerol 버퍼에 보존됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050769-100 Anti-C9orf152 Antibody, chromosome 9 open reading frame 152 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050769-25 Anti-C9orf152 Antibody, chromosome 9 open reading frame 152 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C9orf152 Antibody
Anti-C9orf152 Antibody
Target: chromosome 9 open reading frame 152 (C9orf152)
Clonality: Polyclonal
Host: Rabbit
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human C9orf152.
Alternative Gene Names
- bA470J20.2
Antigen Information
Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
PQDTSHQVHHRGKLVGSDQRLPPEGDTHLFETNQMTQQGTGIPEAAQLPCQVGNTQTKAVESGLKFSTQCPLSIKNPHRSGKPAYYPFPQRKTPRISQAARNL
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000052117 | 49% |
| Rat | ENSRNOG00000012068 | 49% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| Safety | Material Safety Data Sheet |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



