CacheBy
Atlas Antibodies Anti-C6orf89 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C6orf89 Antibody

상품 한눈에 보기

인간 C6orf89 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 등에 적합하며 BRAP, FLJ25357 유전자 대체명으로도 알려져 있습니다. PrEST 항원을 이용해 친화 정제되었으며, PBS와 글리세롤 기반 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012548-100 Anti-C6orf89 Antibody, chromosome 6 open reading frame 89 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012548-25 Anti-C6orf89 Antibody, chromosome 6 open reading frame 89 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C6orf89 Antibody

Anti-C6orf89 Antibody

Target: chromosome 6 open reading frame 89 (C6orf89)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human C6orf89.


Alternative Gene Names

  • BRAP
  • FLJ25357

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 6 open reading frame 89
Target Gene C6orf89
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope sequence:
QPFSPLAPEPVLSGAHTWRSLIHHIRLMSLPIAKKYMSENKGVPLHGGDEDRPFPDFDPWWTNDCEQNESEPIPANCTGCAQKHLKVMLLEDAPRKFERLHPLVIKTGKPLLEEEIQHFLCQYPEATEGFSEGFFAKWWRCFPERWF


Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 동일성
Rat ENSRNOG00000000524 79%
Mouse ENSMUSG00000052712 78%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications: IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.