
Atlas Antibodies Anti-C6orf89 Antibody
상품 한눈에 보기
인간 C6orf89 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 등에 적합하며 BRAP, FLJ25357 유전자 대체명으로도 알려져 있습니다. PrEST 항원을 이용해 친화 정제되었으며, PBS와 글리세롤 기반 버퍼에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C6orf89 Antibody
Target: chromosome 6 open reading frame 89 (C6orf89)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human C6orf89.
Alternative Gene Names
- BRAP
- FLJ25357
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 6 open reading frame 89 |
| Target Gene | C6orf89 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Epitope sequence:
QPFSPLAPEPVLSGAHTWRSLIHHIRLMSLPIAKKYMSENKGVPLHGGDEDRPFPDFDPWWTNDCEQNESEPIPANCTGCAQKHLKVMLLEDAPRKFERLHPLVIKTGKPLLEEEIQHFLCQYPEATEGFSEGFFAKWWRCFPERWF
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 동일성 |
|---|---|---|
| Rat | ENSRNOG00000000524 | 79% |
| Mouse | ENSMUSG00000052712 | 78% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C6orf58 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C6orf89 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C6orf62 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C6orf58 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.