CacheBy
Atlas Antibodies Anti-C6orf58 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C6orf58 Antibody

상품 한눈에 보기

인간 C6orf58 단백질에 특이적인 폴리클로날 항체로, IHC 및 RNA-seq 데이터 기반 정교한 Orthogonal 검증 수행. 토끼에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제됨. PBS와 글리세롤 버퍼에 보존제로 나트륨 아지드 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041449-100 Anti-C6orf58 Antibody, chromosome 6 open reading frame 58 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041449-25 Anti-C6orf58 Antibody, chromosome 6 open reading frame 58 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C6orf58 Antibody

Anti-C6orf58 Antibody

Target: chromosome 6 open reading frame 58 (C6orf58)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human C6orf58.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 6 open reading frame 58
Target Gene C6orf58
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GTSNLSETEPPLWKESPGQLSDYRVENSMYIINPWVYLERMGMYKIILNQTARYFAKFAPDNEQNILWGLPLQYGWQYRTGRLADPTRR

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID 항원 서열 유사도
Mouse ENSMUSG00000015519 65%
Rat ENSRNOG00000012581 64%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Application
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.