Atlas Antibodies Anti-C6orf62 Antibody

상품 한눈에 보기

Human C6orf62 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 Western blot에 적합하며, RNA-seq 데이터 기반 Orthogonal 검증 및 재조합 단백질 발현 검증 완료. Rabbit 호스트, IgG 아이소타입, Affinity purified 제품.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA030564-100 Anti-C6orf62 Antibody, chromosome 6 open reading frame 62 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA030564-25 Anti-C6orf62 Antibody, chromosome 6 open reading frame 62 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C6orf62 Antibody

Anti-C6orf62 Antibody

Target: chromosome 6 open reading frame 62 (C6orf62)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Recombinant expression validation): Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human C6orf62

Alternative Gene Names

DKFZP564G182, FLJ12619, XTP12

Open Datasheet

Specifications

항목	내용
Target Protein	chromosome 6 open reading frame 62
Target Gene	C6orf62
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	NSRKKQALNRLRAQLRKKKESLADQFDFKMYIAFVFKEKKKKSALFEVSEVIPVMTNNYEENILKGVRDS
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000018456 (100%), Mouse ENSMUSG00000019132 (100%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.