AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C6orf58 Antibody
상품 한눈에 보기
Human C6orf58 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 통한 단백질 발현 정량에 적합. RNA-seq 데이터와의 Orthogonal 검증 완료. PrEST 항원으로 정제되었으며, PBS 및 글리세롤 완충액에 보존됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036263-100 Anti-C6orf58 Antibody, chromosome 6 open reading frame 58 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036263-25 Anti-C6orf58 Antibody, chromosome 6 open reading frame 58 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C6orf58 Antibody
Anti-C6orf58 Antibody
Target: chromosome 6 open reading frame 58 (C6orf58)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human C6orf58
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 6 open reading frame 58 |
| Target Gene | C6orf58 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence | GTSNLSETEPPLWKESPGQLSDYRVENSMYIINPWVYLERMGMYKIILNQTARYFAKFAPDNEQNILWGLPLQYGWQYRTGRLADPTRR |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000015519 (65%) Rat ENSRNOG00000012581 (64%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.