
Atlas Antibodies Anti-C6orf47 Antibody
상품 한눈에 보기
Human C6orf47 단백질에 특이적인 폴리클로날 항체로, Rabbit에서 생산됨. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 정제된 고순도 항체. 인간에 대한 반응성이 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C6orf47 Antibody
Target: chromosome 6 open reading frame 47 (C6orf47)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human C6orf47.
Alternative Gene Names
D6S53E, G4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 6 open reading frame 47 |
| Target Gene | C6orf47 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | EPSKEEPQVEQLGSKRMDSLKWDQPISSTQESGRLEAGGASPKLRWDHVDSGGTRRPGVSPEGGLSVPGPGAPLEK |
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Identity (%) |
|---|---|---|
| Rat | ENSRNOG00000039658 | 59% |
| Mouse | ENSMUSG00000043311 | 58% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C6orf62 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C6orf58 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C6orf47 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C6orf47 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C6orf52 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.